PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_051960_ggyu.t2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26803.3 Da    PI: 7.8713
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_051960_ggyu.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.61.2e-26959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien +nrqvtfskRr+g+lKK +EL +LCda++ +iifs tgkl++y++
  Bv3_051960_ggyu.t2  9 KRIENRTNRQVTFSKRRQGLLKKTNELAILCDAQIGLIIFSGTGKLHTYPN 59
                        79***********************************************95 PP

2K-box661.3e-22831641394
               K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                         +  + +qel+ L++ i+n +++ Rh+lGe+L++L l++L++ eqqLe+sl+ iR++Kn+l+ +q+e+l++ke+ lq +n ++
  Bv3_051960_ggyu.t2  83 NRDEIYQELQALREAIHNGEQSMRHYLGENLGPLPLEDLHKHEQQLESSLNIIRARKNQLMQQQLENLRRKEQLLQTDNGNM 164
                         567899***********************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.936161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-37160IPR002100Transcription factor, MADS-box
CDDcd002655.27E-40278No hitNo description
SuperFamilySSF554551.23E-30281IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-273859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2282167IPR002487Transcription factor, K-box
PROSITE profilePS5129714.56684180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGKIEMKR IENRTNRQVT FSKRRQGLLK KTNELAILCD AQIGLIIFSG TGKLHTYPNP  60
TSLEQIIQRY LHVQGIQLPL HDNRDEIYQE LQALREAIHN GEQSMRHYLG ENLGPLPLED  120
LHKHEQQLES SLNIIRARKN QLMQQQLENL RRKEQLLQTD NGNMYRWLMG DGQLHEQQQQ  180
QVIGQMPFIY GGEDQPSSST ILQLATSSSS PHQYFPYRLQ PTHPNLQDYE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D9e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A9e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-16270168Myocyte-specific enhancer factor 2A
3p57_I1e-16270168Myocyte-specific enhancer factor 2A
3p57_D1e-16270168Myocyte-specific enhancer factor 2A
3p57_C1e-16270168Myocyte-specific enhancer factor 2A
3p57_B1e-16270168Myocyte-specific enhancer factor 2A
3p57_A1e-16270168Myocyte-specific enhancer factor 2A
3kov_J1e-16270168Myocyte-specific enhancer factor 2A
3kov_I1e-16270168Myocyte-specific enhancer factor 2A
3kov_B1e-16270168Myocyte-specific enhancer factor 2A
3kov_A1e-16270168Myocyte-specific enhancer factor 2A
1tqe_S2e-16170169Myocyte-specific enhancer factor 2B
1tqe_R2e-16170169Myocyte-specific enhancer factor 2B
1tqe_Q2e-16170169Myocyte-specific enhancer factor 2B
1tqe_P2e-16170169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010671447.11e-169PREDICTED: MADS-box protein FBP24 isoform X1
SwissprotQ9ATE58e-74FBP24_PETHY; MADS-box protein FBP24
TrEMBLA0A0J8CVE91e-168A0A0J8CVE9_BETVU; Uncharacterized protein
STRINGVIT_10s0042g00820.t015e-63(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.23e-58MIKC_MADS family protein